Psmg2 Rabbit Polyclonal Antibody

CAT#: TA331669

Rabbit Polyclonal Anti-Psmg2 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Psmg2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Psmg2 Antibody is: synthetic peptide directed towards the middle region of Mouse Psmg2. Synthetic peptide located within the following region: YLLTPCLQKSVQNKIKSLNWLEMEKSRCIPEMSDSEFCIRIPGGGITKTL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name proteasome (prosome, macropain) assembly chaperone 2
Background Psmg2 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.
Synonyms CLAST3; HCCA3; HDCMC29P; HSPC260; HsT1707; MDS003; MGC15092; PAC-2; PAC2; TNFSF5IP1
Note Immunogen sequence homology: Human: 100%; Bovine: 93%; Rabbit: 93%; Pig: 92%; Rat: 92%; Mouse: 92%; Sheep: 92%; Guinea pig: 92%; Goat: 86%; Dog: 83%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.