TARS3 Rabbit Polyclonal Antibody

CAT#: TA331627

Rabbit Polyclonal Anti-TARSL2 Antibody

Product Images

Host: Rabbit; Target Name: TARSL2; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TARSL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human TARSL2. Synthetic peptide located within the following region: TYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 88 kDa
• Gene Name: threonyl-tRNA synthetase-like 2
• Database Link:
  NP_689547
  Entrez Gene 123283 Human
  UniProt ID A2RTX5
• Background: The function of this protein remains unknown.
• Synonyms: FLJ25005
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 86%; Zebrafish: 86%

Reference Data

• Protein Pathways: Aminoacyl-tRNA biosynthesis