GBP6 Rabbit Polyclonal Antibody

CAT#: TA331528

Rabbit Polyclonal Anti-GBP6 Antibody

Product Images

Host: Rabbit; Target Name: GBP6; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GBP6 Antibody is: synthetic peptide directed towards the N-terminal region of Human GBP6. Synthetic peptide located within the following region: MWCVPHPSKPNHTLVLLDTEGLGDVEKGDPKNDSWIFALAVLLCSTFVYN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: guanylate binding protein family member 6
• Database Link:
  NP_940862
  Entrez Gene 163351 Human
  UniProt ID Q6ZN66
• Background: Guanylate-binding proteins, such as GBP6, are induced by interferon and hydrolyze GTP to both GDP and GMP.
• Synonyms: DKFZp686G0786; FLJ39135
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 85%