BRDG 1 (STAP1) Rabbit Polyclonal Antibody

CAT#: TA331361

Rabbit Polyclonal Anti-STAP1 Antibody

Product Images

WB Suggested Anti-STAP1 Antibody; Titration: 1.0 ug/ml; Positive Control: HCT15 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-STAP1 antibody is: synthetic peptide directed towards the middle region of Human STAP1. Synthetic peptide located within the following region: TELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQSTSVEKEKEPTEDYV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: signal transducing adaptor family member 1
• Database Link:
  NP_036240
  Entrez Gene 26228 Human
  UniProt ID Q9ULZ2
• Background: The protein encoded by this gene functions as a docking protein acting downstream of Tec tyrosine kinase in B cell antigen receptor signaling. The protein is directly phosphorylated by Tec in vitro where it participates in a postive feedback loop, increasing Tec activity.
• Synonyms: BRDG1; STAP-1
• Note: Human: 100%; Horse: 77%; Yeast: 77%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome