GPR183 Rabbit Polyclonal Antibody

CAT#: TA331259

Rabbit Polyclonal Anti-GPR183 Antibody

Product Images

WB Suggested Anti-GPR183 Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GPR183 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR183. Synthetic peptide located within the following region: SLPWILLGACFIGYVLPLIIILICYSQICCKLFRTAKQNPLTEKSGVNKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: G protein-coupled receptor 183
• Database Link:
  NP_004942
  Entrez Gene 1880 Human
  UniProt ID P32249
• Background: This gene was identified by the up-regulation of its expression upon Epstein-Barr virus infection of primary B lymphocytes. This gene is predicted to encode a G protein-coupled receptor that is most closely related to the thrombin receptor. Expression of this gene was detected in B-lymphocyte cell lines and lymphoid tissues but not in T-lymphocyte cell lines or peripheral blood T lymphocytes. The function of this gene is unknown.
• Synonyms: EBI2; hEBI2
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane