EIF2B3 Rabbit Polyclonal Antibody

CAT#: TA331248

Rabbit Polyclonal Anti-EIF2B3 Antibody

Product Images

WB Suggested Anti-EIF2B3 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Liver

• 

  Host: Rabbit; Target Name: EIF2B3; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EIF2B3 antibody is: synthetic peptide directed towards the middle region of Human EIF2B3. Synthetic peptide located within the following region: ENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLKKKELKSLDIYSF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: eukaryotic translation initiation factor 2B subunit gamma
• Database Link:
  NP_065098
  Entrez Gene 8891 Human
  UniProt ID Q9NR50
• Background: The protein encoded by this gene is one of the subunits of initiation factor eIF2B, which catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. It has also been found to function as a cofactor of hepatitis C virus internal ribosome entry site-mediated translation. Mutations in this gene have been associated with leukodystrophy with vanishing white matter. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: EIF-2B; EIF2Bgamma
• Note: Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Yeast: 90%; Mouse: 86%