EIF2B3 Rabbit Polyclonal Antibody
USD 665.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-EIF2B3 antibody is: synthetic peptide directed towards the middle region of Human EIF2B3. Synthetic peptide located within the following region: ENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLKKKELKSLDIYSF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 50 kDa |
Gene Name | eukaryotic translation initiation factor 2B subunit gamma |
Database Link | |
Background | The protein encoded by this gene is one of the subunits of initiation factor eIF2B, which catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. It has also been found to function as a cofactor of hepatitis C virus internal ribosome entry site-mediated translation. Mutations in this gene have been associated with leukodystrophy with vanishing white matter. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Synonyms | EIF-2B; EIF2Bgamma |
Note | Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Yeast: 90%; Mouse: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review