TBC1D3 Rabbit Polyclonal Antibody

CAT#: TA331236

Rabbit Polyclonal Anti-TBC1D3 Antibody

Product Images

WB Suggested Anti-TBC1D3 Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole Cell

• 

  Host: Rabbit; Target Name: TBC1D3; Sample Tissue: Human Jurkat; Antibody Dilution: 1.0ug/ml; TBC1D3 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Host: Rabbit; Target Name: TBC1D3; Sample Tissue: Human 293T; Antibody Dilution: 1.0ug/ml; TBC1D3 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TBC1D3 antibody is: synthetic peptide directed towards the C-terminal region of Human TBC1D3. Synthetic peptide located within the following region: NRFVDTWARDEDTVLKHLRASMKKLTRKQGDLPPPAKPEQGSSASRPVPA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: TBC1 domain family member 3
• Database Link:
  NP_001116863
  Entrez Gene 729873 Human
  UniProt ID Q8IZP1
• Background: TBC1D3 acts as a GTPase activating protein for RAB5. TBC1D3 does not act on RAB4 or RAB11.
• Synonyms: PRC17; TBC1D3A; TBC1D3F
• Note: Human: 100%