DLL4 Rabbit Polyclonal Antibody

CAT#: TA331080

Rabbit polyclonal Anti-DLL4 Antibody

Product Images

WB Suggested Anti-DLL4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:2500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DLL4 antibody: synthetic peptide directed towards the N terminal of human DLL4. Synthetic peptide located within the following region: PGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: delta like canonical Notch ligand 4
• Database Link:
  NP_061947
  Entrez Gene 54567 Human
  UniProt ID Q9NR61
• Background: Notch ligands family members are characterized by a DSL domain, EGF repeats, and a transmembrane domain. DLL4 plays a role in the Notch signaling pathway. IT activates Notch-1 and Notch-4.
• Synonyms: hdelta2
• Note: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rabbit: 93%; Bovine: 86%; Guinea pig: 86%; Rat: 79%

Reference Data

• Protein Families: Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transmembrane
• Protein Pathways: Notch signaling pathway