DNAJC10 Rabbit Polyclonal Antibody

CAT#: TA331073

Rabbit polyclonal Anti-DNAJC10 Antibody

Product Images

WB Suggested Anti-DNAJC10 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:2500; Positive Control: ACHN cell lysate; DNAJC10 is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DNAJC10 antibody: synthetic peptide directed towards the N terminal of human DNAJC10. Synthetic peptide located within the following region: DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 91 kDa
• Gene Name: DnaJ heat shock protein family (Hsp40) member C10
• Database Link:
  NP_061854
  Entrez Gene 54431 Human
  UniProt ID Q8IXB1
• Background: This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.
• Synonyms: ERdj5; JPDI; MTHr; PDIA19
• Note: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Zebrafish: 83%

Reference Data

• Protein Families: Druggable Genome, Transmembrane