SULT1A1 Rabbit Polyclonal Antibody

CAT#: TA331008

Rabbit polyclonal Anti-SULT1A1 Antibody

Product Images

WB Suggested Anti-SULT1A1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

• 

  SULT1A1 antibody - N-terminal region;Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue;Observed Staining: Cytoplasm in hepatocytes;Primary Antibody Concentration: 1:100

• 

  SULT1A1 antibody - N-terminal region;Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue;Observed Staining: Cytoplasm of pneumocytes;Primary Antibody Concentration: 1:100

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SULT1A1 antibody: synthetic peptide directed towards the N terminal of human SULT1A1. Synthetic peptide located within the following region: ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: sulfotransferase family 1A member 1
• Database Link:
  NP_001046
  Entrez Gene 6817 Human
  UniProt ID P50225
• Background: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene.
• Synonyms: HAST1; HAST2; P-PST; PST; ST1A1; ST1A3; STP; STP1; TSPST1
• Note: Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 86%; Zebrafish: 86%; Guinea pig: 86%

Reference Data

• Protein Pathways: Sulfur metabolism