GLIPR1L2 Rabbit Polyclonal Antibody

CAT#: TA330807

Rabbit Polyclonal Anti-GLIPR1L2 Antibody

Product Images

Host: Rabbit; Target Name: GLIPR1L2; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GLIPR1L2 antibody is: synthetic peptide directed towards the C-terminal region of Human GLIPR1L2. Synthetic peptide located within the following region: IFTPEESEAGNEEEEKEEEKKEKEEMEMEIMEMEEEKEEREEEEEETQKE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: GLI pathogenesis-related 1 like 2
• Database Link:
  NP_689649
  Entrez Gene 144321 Human
  UniProt ID Q4G1C9
• Background: This gene encodes a member of the cysteine-rich secretory protein, antigen 5, and pathogenesis-related 1 superfamily. Members of this family have roles in a variety of processes, including cancer and immune defense. This gene is located in a cluster with two related genes on chromosome 12. Alternative splicing results in multiple transcript variants.
• Synonyms: MGC39497
• Note: Human: 100%; Yeast: 100%; Rabbit: 83%; Dog: 77%; Rat: 77%; Zebrafish: 75%