LHX6 Rabbit Polyclonal Antibody

CAT#: TA330601

Rabbit Polyclonal Anti-LHX6 Antibody

Product Images

WB Suggested Anti-LHX6 Antibody Titration: 1.0ug/ml; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: LHX6; Sample Tissue: HepG2; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:2.5ug/mL; Peptide Concentration: 2.0ug/mL; Lysate Quantity: 25ug/lane; Gel Concentration: 12%

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LHX6 antibody: synthetic peptide directed towards the C terminal of human LHX6. Synthetic peptide located within the following region: LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: LIM homeobox 6
• Database Link:
  NP_055183
  Entrez Gene 26468 Human
  UniProt ID Q9UPM6
• Background: LHX6 is a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells.
• Synonyms: LHX6.1
• Note: Dog: 100%; Rat: 100%; Human: 100%; Pig: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors