HINFP Rabbit Polyclonal Antibody

CAT#: TA330595

Rabbit Polyclonal Anti-MIZF Antibody

Product Images

WB Suggested Anti-MIZF Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Transfected 293T

• 

  2Hum. Adult Placenta; Host: Rabbit; Target Name: CHAD; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MIZF antibody: synthetic peptide directed towards the middle region of human MIZF. Synthetic peptide located within the following region: FKDRSKLREHLRSHTQEKVVACPTCGGMFANNTKFLDHIRRQTSLDQQHF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: histone H4 transcription factor
• Database Link:
  NP_945322
  Entrez Gene 25988 Human
  UniProt ID Q9BQA5
• Background: MIZF interacts with methyl-CpG-binding protein-2 (MBD2; MIM 603547), a component of the MeCP1 histone deacetylase (HDAC) complex, and plays a role in DNA methylation and transcription repression.MIZF interacts with methyl-CpG-binding protein-2 (MBD2; MIM 603547), a component of the MeCP1 histone deacetylase (HDAC) complex, and plays a role in DNA methylation and transcription repression. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-62 BF726036.1 1-62 63-1549 BC017234.2 47-1533 1550-2058 AK056362.1 1518-2026 2059-2202 BC001073.2 2085-2228
• Synonyms: HiNF-P; MIZF; ZNF743
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Transcription Factors