RNF32 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of ring finger protein 32 (RNF32), transcript variant 1
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "RNF32"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RNF32 antibody: synthetic peptide directed towards the middle region of human RNF32. Synthetic peptide located within the following region: ACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 40 kDa |
Gene Name | ring finger protein 32 |
Database Link | |
Background | RNF32 contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. Its gene was found to be expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids.The protein encoded by this gene contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. This gene was found to be expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids. Several alternatively spliced transcript variants exist, but their full length natures are not clear. |
Synonyms | FKSG33; HSD15; LMBR2 |
Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.