RGS5 Rabbit Polyclonal Antibody

CAT#: TA330399

Rabbit Polyclonal Anti-RGS5 Antibody

Product Images

WB Suggested Anti-RGS5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human heart

• 

  Hum. Fetal Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RGS5 antibody: synthetic peptide directed towards the middle region of human RGS5. Synthetic peptide located within the following region: PGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: regulator of G-protein signaling 5
• Database Link:
  NP_003608
  Entrez Gene 8490 Human
  UniProt ID O15539
• Background: The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-663 AU130764.1 1-663 664-2587 BX537427.1 499-2422 2588-3235 BU187973.1 34-681 3236-3746 AL600981.1 90-600 3747-4143 AA486366.1 76-472 4144-4358 AA974387.1 113-327 c 4359-4664 BX537427.1 4194-4499 4665-5573 AF176919.1 724-1632 5574-5848 BX537427.1 5409-5683
• Synonyms: MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Human: 100%; Guinea pig: 92%; Mouse: 84%; Rat: 84%; Pig: 76%

Reference Data

• Protein Families: Druggable Genome