Cyclin T1 (CCNT1) Rabbit Polyclonal Antibody

CAT#: TA330358

Rabbit Polyclonal Anti-CCNT1 Antibody

Product Images

WB Suggested Anti-CCNT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: 721_B cell lysateCCNT1 is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Host: Rabbit; Target Name: CCNT1; Sample Tissue: MCF7; Antibody Dilution: 1.0ug/ml; CCNT1 is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: CCNT1; Sample Tissue: Hela; Antibody Dilution: 1.0ug/ml; CCNT1 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCNT1 antibody: synthetic peptide directed towards the N terminal of human CCNT1. Synthetic peptide located within the following region: EGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: cyclin T1
• Database Link:
  NP_001231
  Entrez Gene 904 Human
  UniProt ID O60563
• Background: CCNT1 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin tightly associates with CDK9 kinase, and was found to be a major subunit of the transcription elongation factor p-TEFb. The kinase complex containing this cyclin and the elongation factor can interact with, and act as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and was shown to be both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner were also found to be involved in the phosphorylation and regulation of the carboxy-terminal domain (CTD) of the largest RNA polymerase II subunit.The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin tightly associates with CDK9 kinase, and was found to be a major subunit of the transcription elongation factor p-TEFb. The kinase complex containing this cyclin and the elongation factor can interact with, and act as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and was shown to be both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner were also found to be involved in the phosphorylation and regulation of the carboxy-terminal domain (CTD) of the largest RNA polymerase II subunit. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CCNT; CYCT1; HIVE1
• Note: Immunogen sequence homology: Bovine: 100%; Goat: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Dog: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors