Nucleobindin 1 (NUCB1) Rabbit Polyclonal Antibody

CAT#: TA330179

Rabbit Polyclonal Anti-NUCB1 Antibody

Product Images

Host: Rabbit; Target Name: NUCB1; Sample Tissue: HepG2 lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NUCB1 antibody: synthetic peptide directed towards the C terminal of human NUCB1. Synthetic peptide located within the following region: PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: nucleobindin 1
• Database Link:
  NP_006175
  Entrez Gene 4924 Human
  UniProt ID Q02818
• Background: Calnuc or NUCB1 belongs to the nucleobindin family. It is a major calcium-binding protein of the Golgi and is a good Golgi marker. It may be involved in calcium homeostasis. Calnuc also plays roles in regulation of levels of .-amyloid precursor protein (APP) and its proteolytic metabolites to further affect the patho/physiological functions of APP including Alzheimer's disease pathogenesis. Useful for immunohistochemistry and western blot.
• Synonyms: CALNUC; NUC
• Note: Immunogen sequence homology: Human: 100%