YY1 Rabbit Polyclonal Antibody

CAT#: TA330124

Rabbit Polyclonal Anti-YY1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of YY1 transcription factor (YY1)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-YY1 antibody: synthetic peptide directed towards the middle region of human YY1. Synthetic peptide located within the following region: KQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 45 kDa
Gene Name YY1 transcription factor
Background YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
Synonyms DELTA; INO80S; NF-E1; UCRBP; YIN-YANG-1
Note Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.