5HT3A receptor (HTR3A) Rabbit Polyclonal Antibody

CAT#: TA329996

Rabbit Polyclonal Anti-HTR3A Antibody

Product Images

WB Suggested Anti-HTR3A Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HTR3A antibody: synthetic peptide directed towards the N terminal of human HTR3A. Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: 5-hydroxytryptamine receptor 3A
• Database Link:
  NP_000860
  Entrez Gene 3359 Human
  UniProt ID P46098
• Background: HTR3A belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Synonyms: 5-HT-3; 5-HT3A; 5-HT3R; 5HT3R; HTR3
• Note: Immunogen sequence homology: Human: 100%; Horse: 91%; Bovine: 78%; Dog: 78%; Mouse: 78%; Rat: 78%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane