Onecut3 Rabbit Polyclonal Antibody

CAT#: TA329991

Rabbit Polyclonal Anti-Onecut3 Antibody

Product Images

WB Suggested Anti-Onecut3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Onecut3 antibody: synthetic peptide directed towards the c terminal of mouse Onecut3. Synthetic peptide located within the following region: QEPEFQRMSALRLAACKRKEQDQQKERALQPKKQRLVFTDLQRRTLIAIF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: one cut domain, family member 3
• Database Link:
  NP_631972
  Entrez Gene 246086 Mouse
  UniProt ID Q8K557
• Background: Onecut3 is a transcriptional activator. Onecut3 binds the consensus DNA sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR.
• Synonyms: OC-3; OC3
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 90%; Zebrafish: 79%