CGI 62 (ZC2HC1A) Rabbit Polyclonal Antibody

CAT#: TA329896

Rabbit Polyclonal Anti-C8orf70 Antibody

Product Images

WB Suggested Anti-C8orf70 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C8orf70 antibody: synthetic peptide directed towards the middle region of human C8orf70. Synthetic peptide located within the following region: QAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: zinc finger C2HC-type containing 1A
• Database Link:
  NP_057094
  Entrez Gene 51101 Human
  UniProt ID Q96GY0
• Background: The exact function of FAM164A(C8orf70) remains unknown.
• Synonyms: C8orf70; CGI-62; FAM164A
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Rabbit: 93%; Bovine: 92%; Horse: 86%; Mouse: 79%