SMAD5 Rabbit Polyclonal Antibody

CAT#: TA329743

Rabbit Polyclonal Anti-SMAD5 Antibody

Product Images

WB Suggested Anti-SMAD5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

• 

  Lanes: Lane 1: 5ug of transfected 293T lysate (SMAD1); Lane 1: 5ug of transfected 293T lysate (SMAD2); Lane 1: 5ug of transfected 293T lysate (SMAD3); Lane 1: 5ug of transfected 293T lysate (SMAD4); Lane 1: 5ug of transfected 293T lysate (SMAD5); Lane 1:

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMAD5 antibody: synthetic peptide directed towards the middle region of human SMAD5. Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: SMAD family member 5
• Database Link:
  NP_005894
  Entrez Gene 59328 RatEntrez Gene 4090 Human
  UniProt ID Q99717
• Background: SMAD5 undergoes copy number gain and increased expression, rather than loss of expression, and therefore does not act as a tumor-suppressor gene in hepatocellular carcinoma. Up-regulated Smad5 mediates apoptosis of gastric epithelial cells induced by Helicobacter pylori infection.
• Synonyms: DWFC; JV5-1; MADH5
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Sheep: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors
• Protein Pathways: TGF-beta signaling pathway