Zhx3 Rabbit Polyclonal Antibody

CAT#: TA329616

Rabbit polyclonal anti-Zhx3 antibody


USD 539.00

2 Weeks*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Zhx3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Zhx3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGEPVAVHKVLGDAYSELSENSESWEPSAPEASSEPFDTSSPQSGRQLEA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 104 kDa
Gene Name zinc fingers and homeoboxes 3
Background Zhx3 acts as a transcriptional repressor. Is a regulator of podocyte gene expression during primary glomerula disease.
Synonyms KIAA0395; OTTHUMP00000031006; TIX1
Note Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Bovine: 86%; Pig: 83%; Yeast: 83%; Guinea pig: 83%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.