Cphx1 Rabbit Polyclonal Antibody

CAT#: TA329610

Rabbit polyclonal anti-C330003B14RIK antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Cphx1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C330003B14RIK antibody: synthetic peptide directed towards the N terminal of mouse C330003B14RIK. Synthetic peptide located within the following region: MLSKNFPGAPETKDNRSKARKRYGSRNSKPRHKFSRDELKRLKQEFAYAP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 20 kDa
Gene Name cytoplasmic polyadenylated homeobox 1
Background The function remains unknown.
Synonyms AU019881; AU023336; C80129; C330003B14Rik; Cphx; Eso-1
Note Immunogen sequence homology: Mouse: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.