Lcorl Rabbit Polyclonal Antibody

CAT#: TA329595

Rabbit polyclonal anti-A830039H10RIK antibody

Product Images

WB Suggested Anti-A830039H10RIK Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Testis

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-A830039H10RIK antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: ligand dependent nuclear receptor corepressor-like
• Database Link:
  NP_742165
  Entrez Gene 254251 Human
  UniProt ID Q3U285
• Background: This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome.
• Synonyms: FLJ30696; MLR1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%