UBE2E1 Rabbit Polyclonal Antibody

CAT#: TA329562

Rabbit Polyclonal anti-Ube2h Antibody

Product Images

Host: Rabbit; Target Name: Ube2h; Sample Tissue: Rat Heart lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ube2h antibody is: synthetic peptide directed towards the C-terminal region of Rat Ube2h. Synthetic peptide located within the following region: FESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: ubiquitin conjugating enzyme E2 E1
• Database Link:
  NP_872607
  Entrez Gene 7324 Human
  UniProt ID P51965
• Background: Ube2h is an E3 ubiquitin-protein ligase.
• Synonyms: UBCH6
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 85%

Reference Data

• Protein Pathways: Ubiquitin mediated proteolysis