UBE2E1 (NM_182666) Human Recombinant Protein
CAT#: TP314934
Recombinant protein of human ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast) (UBE2E1), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214934 representing NM_182666
Red=Cloning site Green=Tags(s) MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKSAGPKGDNIYEWRSTILGPP GSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLT DCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872607 |
Locus ID | 7324 |
UniProt ID | P51965 |
Cytogenetics | 3p24.2 |
Refseq Size | 1428 |
Refseq ORF | 528 |
Synonyms | UBCH6 |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405441 | UBE2E1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405441 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast) (UBE2E1), transcript variant 2 |
USD 436.00 |
|
PH314934 | UBE2E1 MS Standard C13 and N15-labeled recombinant protein (NP_872607) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review