Gjb3 Rabbit Polyclonal Antibody

CAT#: TA329540

Rabbit Polyclonal anti-Gjb3 antibody

Product Images

WB Suggested Anti-Gjb3 Antibody Titration: 0.125 ug/ml; ELISA Titer: 1:1562500; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Gjb3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MDWKKLQDLLSGVNQYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: gap junction protein, beta 3
• Database Link:
  NP_032152
  Entrez Gene 14620 Mouse
  UniProt ID P28231
• Background: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
• Synonyms: Connexin-31; CX31; DFNA2; DFNA2B; EKV; FLJ22486; MGC102938
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Zebrafish: 92%; Dog: 83%; Pig: 83%; Horse: 83%; Human: 83%; Bovine: 79%; Rabbit: 79%