C6orf134 (ATAT1) Rabbit Polyclonal Antibody

CAT#: TA329480

Rabbit Polyclonal anti-C6orf134 antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Transient overexpression lysate of chromosome 6 open reading frame 134 (C6orf134), transcript variant 1
    • 100 ug

USD 436.00

Other products for "C6orf134"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C6orf134 antibody: synthetic peptide directed towards the middle region of human C6orf134. Synthetic peptide located within the following region: DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name alpha tubulin acetyltransferase 1
Background The exact function of C6orf134 remains unknown.
Synonyms alpha-TAT; alpha-TAT1; C6orf134; MEC17; Nbla00487; TAT
Note Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.