MYCBP Rabbit Polyclonal Antibody

CAT#: TA329426

Rabbit Polyclonal anti-MYCBP antibody

Product Images

WB Suggested Anti-MYCBP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysateMYCBP is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Rabbit Anti-MYCBP Antibody; Paraffin Embedded Tissue: Human Intestine; Cellular Data: Epithelial cells of intestinal villas; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-MYCBP Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYCBP antibody: synthetic peptide directed towards the middle region of human MYCBP. Synthetic peptide located within the following region: AATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: MYC binding protein
• Database Link:
  NP_036465
  Entrez Gene 26292 Human
  UniProt ID Q99417
• Background: The MYCBP gene encodes a protein that binds to the N-terminal region of MYC and stimulates the activation of E box-dependent transcription by MYC.
• Synonyms: AMY-1
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transcription Factors