POU5F2 Rabbit Polyclonal Antibody

CAT#: TA329333

Rabbit Polyclonal anti-POU5F2 antibody

Product Images

WB Suggested Anti-POU5F2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POU5F2 antibody: synthetic peptide directed towards the N terminal of human POU5F2. Synthetic peptide located within the following region: EFRGWIAPCRPRLGASEAGDWLRRPSEGALPGPYIALRSIPKLPPPEDIS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: POU domain class 5, transcription factor 2
• Database Link:
  NP_694948
  Entrez Gene 134187 Human
  UniProt ID Q8N7G0
• Background: POU5F2 is a transcription factor that binds preferentially to the octamer motif (5'-ATGTTAAT-3'). It may exert a regulatory function in meiotic events that are required for terminal differentiation of male germ cell.
• Synonyms: SPRM-1
• Note: Immunogen sequence homology: Human: 100%; Rat: 77%; Mouse: 77%

Reference Data

• Protein Families: Transcription Factors