CEBP Beta (CEBPB) Rabbit Polyclonal Antibody

CAT#: TA329231

Rabbit Polyclonal anti-CEBPB antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), 20 µg
    • 20 ug

USD 867.00

Other products for "CEBP Beta"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CEBPB antibody: synthetic peptide directed towards the C terminal of human CEBPB. Synthetic peptide located within the following region: ADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name CCAAT/enhancer binding protein beta
Background The protein encoded by this intronless gene, CEBPB, is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related proteins CEBP-alpha, CEBP-delta, and CEBP-gamma. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses and has been shown to bind to the IL-1 response element in the IL-6 gene, as well as to regulatory regions of several acute-phase and cytokine genes. In addition, the encoded protein can bind the promoter and upstream element and stimulate the expression of the collagen type I gene.
Synonyms C; EBP-beta; IL6DBP; NF-IL6; TCF5
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 92%
Reference Data
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.