Hand2 Rabbit Polyclonal Antibody

CAT#: TA329158

Rabbit Polyclonal anti-Hand2 antibody

Product Images

WB Suggested Anti-Hand2 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Heart

• 

  Host: Rabbit; Target Name: Hand2; Sample Tissue: Mouse Heart lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Hand2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: heart and neural crest derivatives expressed transcript 2
• Database Link:
  NP_034532
  Entrez Gene 15111 Mouse
  UniProt ID Q61039
• Background: Hand2 is essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. It is required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. It plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Hand2 is involved in the development of branchial arches, which give rise to unique structures in the head and neck.
• Synonyms: bHLHa26; dHand; DHAND2; FLJ16260; Hed; MGC125303; MGC125304; Thing2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 87%