TSC22 domain family, member 4 (TSC22D4) Rabbit Polyclonal Antibody

CAT#: TA329117

Rabbit Polyclonal anti-TSC22D4 antibody

Product Images

WB Suggested Anti-TSC22D4 Antibody Titration: 0.5ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

• 

  Rabbit Anti-TSC22D4 Antibody; Paraffin Embedded Tissue: Human Lung; Cellular Data: Alveolar cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-TSC22D4 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TSC22D4 antibody: synthetic peptide directed towards the N terminal of human TSC22D4. Synthetic peptide located within the following region: SGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: TSC22 domain family member 4
• Database Link:
  NP_112197
  Entrez Gene 81628 Human
  UniProt ID Q9Y3Q8
• Background: TSC22D4 is a leucine zipper-containing protein that is highly conserved during evolution. It is transcriptionally up-regulated by many different stimuli, including anti-cancer drugs and growth inhibitors. TSC22D4 may play a suppressive role in tumorigenesis.
• Synonyms: THG-1; THG1; TILZ2
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Dog: 90%; Rat: 77%

Reference Data

• Protein Families: Transcription Factors