Rabbit Polyclonal Anti-GNAO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the middle region of human GNAO1. Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL |
Rabbit polyclonal GNAO1 Antibody (C-term)
| Applications | FC, WB |
| Reactivities | Human, Mouse (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This GNAO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 291-320 amino acids from the C-terminal region of human GNAO1. |
Rabbit Polyclonal Anti-GNAO1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the N terminal of human GNAO1. Synthetic peptide located within the following region: PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF |
Rabbit anti-GNAO1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNAO1 |
Germany
Japan
United Kingdom
China
