Products

cDNA Clones (11)
Antibodies (8)
Proteins (7)
Jump to Filters
View as table Download
EGR1 (NM_001964) Human Recombinant Protein
TP720992

USD 330.00

7 Weeks

Purified recombinant protein of Human early growth response 1 (EGR1)

Tag N-His
Expression Host E. coli
EGR1 Rabbit Polyclonal Antibody
TA319423

USD 765.00

5 Days

Rabbit polyclonal anti-EGR-1 antibody

Applications IHC, WB
Reactivities Human, Chimpanzee, Mouse
Conjugation Unconjugated
Immunogen This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 94-108 (eqpyehltaesfpdi) of Human EGR-1.
EGR1 Rabbit Polyclonal Antibody
TA313795

USD 380.00

In Stock

Rabbit polyclonal anti-EGR1/2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EGR1/2.
EGR1 Rabbit Polyclonal Antibody
TA323079

USD 380.00

4 Weeks

Anti-EGR1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 87-337 amino acids of human early growth response 1early growth response 1
EGR1 (N-term) Rabbit Polyclonal Antibody
AP17311PU-N

USD 580.00

2 Weeks

EGR1 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human EGR1
EGR1 Rabbit Polyclonal Antibody
TA310113

USD 285.00

3 Weeks

Rabbit anti-Egr1 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human Egr1.
EGR1 Rabbit Polyclonal Antibody
TA344360

USD 539.00

5 Days

Rabbit Polyclonal Anti-EGR1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the middle region of human EGR1. Synthetic peptide located within the following region: PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS
EGR1 (NM_001964) Human Recombinant Protein
TP720992L

USD 1,900.00

9 Weeks

Purified recombinant protein of Human early growth response 1 (EGR1)

Tag N-His
Expression Host E. coli
EGR1 (NM_001964) Human Recombinant Protein
TP720992M

USD 760.00

7 Weeks

Purified recombinant protein of Human early growth response 1 (EGR1)

Tag N-His
Expression Host E. coli
EGR1 (NM_001964) Human Recombinant Protein
TP720992XL

USD 1,900.00

7 Weeks

Purified recombinant protein of Human early growth response 1 (EGR1)

Tag N-His
Expression Host E. coli
EGR1 CytoSection
TS409956P5

USD 1,174.00

4 Weeks

Transient overexpression of EGR1 in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Other Names AT225; G0S30; KROX-24; NGFI-A; TIS8; ZIF-268; ZNF225
Accession Number NM_001964, NP_001955