EGR1 (NM_001964) Human Recombinant Protein

CAT#: TP720992

Reviews ()
Write a review

Purified recombinant protein of Human early growth response 1 (EGR1)



  View other "EGR1" proteins (2)

USD 300.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human early growth response 1 (EGR1)
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence MGSSHHHHHHSSGLVPRGSHMQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVAS
Tag N-His
Predicted MW 19.9 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_001955
Locus ID 1958
Refseq Size 3136
Cytogenetics 5q31.2
Refseq ORF 1629
Synonyms AT225; G0S30; KROX-24; NGFI-A; TIS8; ZIF-268; ZNF225
Summary The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppressor gene. [provided by RefSeq, Dec 2014]
Protein Families Druggable Genome
Protein Pathways Prion diseases

Documents

Other Versions

Other products for "EGR1"
Frequently bought together (1)
Rabbit polyclonal anti-EGR1/2 antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101