Products

Jump to Filters
View as table Download
Myeloperoxidase (MPO) (C-term) Rabbit Polyclonal Antibody
AP23272PU-N

USD 560.00

2 Weeks

Myeloperoxidase (MPO) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence mapping at the C-terminal of Human MPO
Myeloperoxidase (MPO) Rabbit Polyclonal Antibody
TA349402

USD 380.00

In Stock

Rabbit Polyclonal Anti-MPO Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MPO
Myeloperoxidase (MPO) Rabbit Polyclonal Antibody
TA343091

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-MPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MPO antibody: synthetic peptide directed towards the N terminal of human MPO. Synthetic peptide located within the following region: QLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVR
Myeloperoxidase (MPO) Rabbit Polyclonal Antibody
TA319305

USD 1,795.00

5 Days

Rabbit polyclonal Myeloperoxidase antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Myeloperoxidase [Human Leukocytes]
Myeloperoxidase (MPO) Rabbit Polyclonal Antibody
AP31673PU-N

USD 685.00

2 Weeks

Myeloperoxidase (MPO) rabbit polyclonal antibody, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen Native human Myeloperoxidase purified from human Neutrophils