Myeloperoxidase(MPO) Rabbit Polyclonal Antibody

CAT#: TA343091

Rabbit Polyclonal Anti-MPO Antibody

Antibody Service


 Product Datasheet for 'TA343091'

USD 360.00


Availability*
2 Weeks

Size
    • 50 ug

Product images

Specifications

Product Data
Clone Name Polyclonal
Applications WB
Recommend Dilution WB
Reactivity Rabbit, Human, Rat, Mouse, Pig, Guinea pig, Dog, Goat, Bovine, Horse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-MPO antibody: synthetic peptide directed towards the N terminal of human MPO. Synthetic peptide located within the following region: QLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVR
Isotype IgG
Formulation Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 84kDa
Gene Name myeloperoxidase
Background Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of netrophils.
Synonyms -
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Rat: 93%; Pig: 86%; Mouse: 86%; Guinea pig: 86%; Dog: 83%; Goat: 79%; Horse: 79%; Bovine: 79%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.