Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-TFAP2A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFAP2A antibody: synthetic peptide directed towards the C terminal of human TFAP2A. Synthetic peptide located within the following region: NLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSS |
Rabbit Polyclonal Anti-AP2A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AP2A1 antibody: synthetic peptide directed towards the C terminal of human AP2A1. Synthetic peptide located within the following region: ILAKLKRKKGPGAGSALDDGRRDPSSNDINGGMEPTPSTVSTPSPSADLL |
Rabbit Polyclonal Anti-AP-2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AP-2 Antibody: A synthesized peptide derived from human AP-2 |
TFAP2A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TFAP2A |
TFAP2A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TFAP2A |
Active filters
Target Symbol
- AP2 ALPHA
Conjugates
- Unconjugated