Products

Jump to Filters
View as table Download
Lactate Dehydrogenase B (LDHB) Rabbit Polyclonal Antibody
TA346572

USD 539.00

5 Days

Rabbit Polyclonal Anti-LDHB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
Lactate Dehydrogenase B (LDHB) Goat Polyclonal Antibody
TA329084

USD 520.00

5 Days

LDHB Goat Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen Internal region (near C terminus) (NARGLTSVINQKLK)
Lactate Dehydrogenase B (LDHB) Goat Polyclonal Antibody
TA327769

USD 520.00

5 Days

LDHB Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region (near N terminus) (EEATVPNNKIT)