Products

Jump to Filters
View as table Download
RPS16 Rabbit Polyclonal Antibody
TA334137

USD 485.00

2 Weeks

Rabbit Polyclonal Anti-RPS16 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS16 Antibody: synthetic peptide directed towards the N terminal of human RPS16. Synthetic peptide located within the following region: SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL
RPS16 Rabbit Polyclonal Antibody
TA334138

USD 485.00

5 Days

Rabbit Polyclonal Anti-RPS16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS16 Antibody: synthetic peptide directed towards the middle region of human RPS16. Synthetic peptide located within the following region: LVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCKSKKFGGPGARAC