Mouse Monoclonal c-Myc Antibody (9E10)
Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Sandwich ELISA, Simple Western, WB |
Reactivities | Human, Mouse, Drosophila |
Conjugation | Unconjugated |
Mouse Monoclonal c-Myc Antibody (9E10)
Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Sandwich ELISA, Simple Western, WB |
Reactivities | Human, Mouse, Drosophila |
Conjugation | Unconjugated |
Mouse Monoclonal p53 Antibody (PAb 240)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Yeast (Does not react with: Xenopus) |
Conjugation | Unconjugated |
Mouse Monoclonal Fibronectin/Anastellin Antibody (2F4)
Applications | ELISA, FC, ICC/IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal iNOS Antibody (4E5)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Mouse Monoclonal c-Myc Antibody (9E11)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Chicken, Yeast |
Conjugation | Unconjugated |
Rabbit Polyclonal c-Myc Antibody
Applications | ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
Rabbit Polyclonal AKT2 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
CDK6 mouse monoclonal antibody, clone 8H4, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
AKT1 (C-term) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Chicken, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
Mouse Monoclonal eNOS Antibody (6H2)
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Akt phospho S473 antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal E2F1 Antibody
Applications | ELISA, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Mouse monoclonal Akt phospho T308 antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
CD51 (ITGAV) (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ITGAV antibody was raised against synthetic peptide |