Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-MYL12B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MYL12B Antibody is: synthetic peptide directed towards the C-terminal region of Human MYL12B. Synthetic peptide located within the following region: EKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE |
MYL12B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
MYL12B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
MYL12B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
MYL12B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Active filters
Target Symbol
- MYL12B
Applications
- WB
Pathways
- Leukocyte transendothelial migration