Rabbit Polyclonal PDK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PDK1 |
Rabbit Polyclonal PDK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PDK1 |
Rabbit Polyclonal PDK1 (Ser241) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PDK1 around the phosphorylation site of Serine 241 |
Modifications | Phospho-specific |
PDPK1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PDPK1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of 3-phosphoinositide dependent protein kinase-1 (PDPK1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit anti-PDPK1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of human PDPK1 |
Rabbit polyclonal anti-PDK1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the C-terminal of human PDK-1 protein. |
Rabbit Polyclonal anti-PDPK1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDPK1 antibody: synthetic peptide directed towards the middle region of human PDPK1. Synthetic peptide located within the following region: IIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVS |
PDPK1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PDPK1 |