PDPK1 Rabbit Polyclonal Antibody

CAT#: TA329143

Rabbit Polyclonal anti-PDPK1 antibody

Product Images

WB Suggested Anti-PDPK1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDPK1 antibody: synthetic peptide directed towards the middle region of human PDPK1. Synthetic peptide located within the following region: IIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: 3-phosphoinositide dependent protein kinase 1
• Database Link:
  NP_002604
  Entrez Gene 5170 Human
  UniProt ID O15530
• Background: PDPK1 phosphorylates and activates not only PKB/AKT, but also PKA, PKC-zeta, RPS6KA1 and RPS6KB1. It may play a general role in signaling processes and in development.
• Synonyms: PDK1; PDPK2; PDPK2P; PRO0461
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Endometrial cancer, Focal adhesion, Insulin signaling pathway, mTOR signaling pathway, Non-small cell lung cancer, PPAR signaling pathway, Prostate cancer