Rabbit Polyclonal SEMA3B Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200). |
Rabbit Polyclonal Anti-SEMA3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SEMA3B antibody is: synthetic peptide directed towards the middle region of Human SEMA3B. Synthetic peptide located within the following region: FRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETA |
Germany
Japan
United Kingdom
China
