Rabbit Polyclonal Anti-ATP2A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ATP2A1 |
Rabbit Polyclonal Anti-ATP2A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ATP2A1 |
Rabbit Polyclonal Anti-ATP2A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW |
Rabbit polyclonal anti-ATP2A1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP2A1. |