Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal CXCR7/RDC-1 Antibody
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1. |
Rabbit Polyclonal NFkB p65 NLS Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Bovine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of the NFkB p65 NLS nuclear localization signal (NLS) (amino acids DTDDRHRIEEKRKRKT) was used as the immunogen for this antibody. |
TAOK1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Rat, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | TAOK1 antibody was raised against synthetic 17 amino acid peptide from C-Terminus of human TAOK1. |
Rabbit Polyclonal RUNX2/CBFA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to somewhere between amino acids 250-300 of human RUNX2 was used as immunogen for this antibody.RUNX2 and RUNX1 share an approximate 66% homology in peptide sequence used as immunogen. |
Germany
Japan
United Kingdom
China
