Research Areas

Jump to Filters
View as table Download
GADD45B Rabbit Polyclonal Antibody
TA346618

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-GADD45B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW
GADD45B Rabbit Polyclonal Antibody
TA350002

USD 380.00

In Stock

Rabbit Polyclonal Anti-GADD45B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GADD45B